Protein Info for DZA65_RS16350 in Dickeya dianthicola ME23

Annotation: lysozyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00959: Phage_lysozyme" amino acids 42 to 147 (106 residues), 91.9 bits, see alignment E=1.8e-30

Best Hits

Swiss-Prot: 57% identical to ENLYS_BPPS1: SAR-endolysin (19) from Bacteriophage PS119

KEGG orthology group: K01185, lysozyme [EC: 3.2.1.17] (inferred from 68% identity to yps:YPTB1805)

MetaCyc: 52% identical to DLP12 prophage; lysozyme (Escherichia coli K-12 substr. MG1655)
Lysozyme. [EC: 3.2.1.17]

Predicted SEED Role

"Lysozyme (EC 3.2.1.17)" (EC 3.2.1.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1H2 at UniProt or InterPro

Protein Sequence (157 amino acids)

>DZA65_RS16350 lysozyme (Dickeya dianthicola ME23)
MSKIKNRLITAATGGAMAIAVALIQNFEGVRYTPYRDVVGVLTVCYGHTGPDIIPRKTYT
EAECQALLRSDLQPVFSTIDQVVTVPMPDARRAALASFAYNVGTGALTRSTMLRKLNAGD
TSEACEELLRWNKAGGREWKGLTNRREVERELCLAGK