Protein Info for DZA65_RS16305 in Dickeya dianthicola ME23

Annotation: general secretion pathway protein GspL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 270 to 292 (23 residues), see Phobius details PF05134: T2SSL" amino acids 42 to 233 (192 residues), 62.8 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: None (inferred from 89% identity to ddd:Dda3937_04110)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2D6 at UniProt or InterPro

Protein Sequence (417 amino acids)

>DZA65_RS16305 general secretion pathway protein GspL (Dickeya dianthicola ME23)
MRPCSIFIKARRWCIAAAILLILVNSMFLKQKKTARLSILLPSSPHGGVRWWWCAAGSSE
PIHQGEAPSLAELTLPAAVRREHDAMLWIPAEQSVLETARVTGKAALSAAQLALLIEDKL
GQPAADFHWWQLDRDSGLIFGCPHVWLSAVLGEVKAAGLNVKQLLPEWWSLPDAPVVLAW
AEQRWLLRFSKGAGYWLPAASVQALLPHITAPESVSLYGPPPVEAARWAAQHPALPDAQR
LTPPEHVGVNLLRGLPASLHITHVRPLHRYIAVASLGLLAAVMMALANALGMVGYQLHQD
TASLQAFYARQSIADANASPPVLERLIQDRQQQLAVSGESNFFDQLADYLTLSRQFHAPV
IARLQFDASQRQLTLDVLLPETEARTLIHTAPAAVSVAVHEAQAEKTHITLIIRRPQ