Protein Info for DZA65_RS16270 in Dickeya dianthicola ME23

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 49 to 116 (68 residues), 62.3 bits, see alignment E=4.8e-21 TIGR02517: type II secretion system protein D" amino acids 49 to 641 (593 residues), 454 bits, see alignment E=4e-140 PF03958: Secretin_N" amino acids 209 to 275 (67 residues), 29.2 bits, see alignment E=1.3e-10 amino acids 276 to 401 (126 residues), 45.5 bits, see alignment E=1e-15 PF00263: Secretin" amino acids 474 to 638 (165 residues), 161.5 bits, see alignment E=2.2e-51

Best Hits

KEGG orthology group: None (inferred from 80% identity to dze:Dd1591_3315)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0F7 at UniProt or InterPro

Protein Sequence (695 amino acids)

>DZA65_RS16270 type II secretion system secretin GspD (Dickeya dianthicola ME23)
MKKFFSAKALFFIFIISQNVYAEKETATDNVHALATPTPENASKKYSASFREVEIKEFVA
TAAQILKKNIIIDPSITGQISVRSYDDLNENQYADFFINVMEAYGYSVVKIDNHTLNVVP
QAQSLRAAWAEGNKGRSKNIVVRLARMNVLSGAELEPILGLIAENSAVKLKYYSSGNLFI
FTGREDVVERLVDIVNQIDNARADSSPTVFNVSQAKASDIAKSLQSTFRNLTPEDKNAPL
IYGNDATRTIMVKGGAHLRAEISRLISAMDVPGQQSRVFFLKYADAVQMAKLFTNNNNPS
GSPEPAGGNTMSMEAMLAQQSPGSMSSGQPANLDGQAASGGTTPAADFSNDSNSMFSDGD
TLVRQTRVHADRDNNALVVSAPPAAMQQAASIIQQLDVRHEQVLVEAIVVEVQKAEGLNL
GIAWGNKNYGGSNFNSINVGNGFSQANPLVNALKGTEGLVAGFYHGNWGTLFNALESNKS
NNIVATPSVVTLDNHRAEFNVGQDVPILTGSQTTNNDNIFNTVQRRTIGIKFSILPRINQ
SGTILLTISQEISSLSDTAQVNNNLGAVFNIRTVNNVVQVQDNETVVIGGLLDDEKKETV
NKVPLLGDIPWLGNVFRYTSHNDDKRNLMLFIRPRIIRSDGAETVQARQGASSAVADEAV
RNSPATQNAPHAIERPTPGVNAILNGIQKFTMSLH