Protein Info for DZA65_RS16245 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 107 (96 residues), 80.6 bits, see alignment E=5.1e-27 PF00528: BPD_transp_1" amino acids 32 to 211 (180 residues), 63.8 bits, see alignment E=9e-22

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 88% identity to dze:Dd1591_1188)

Predicted SEED Role

"Putative ABC amino acid transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0W2 at UniProt or InterPro

Protein Sequence (233 amino acids)

>DZA65_RS16245 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MSSQDIINIGYFLLEGVANTLMVTLTCFTSALITGLAVAVLRRLAFPSIKNILDFLVFTF
RGIPVLIAVFLVYFGLPATGLSISPLLAMNISIGLISGSYLAEVFRGALQLVEQSEITAA
KAAGLSKLQIIRNIELPQMLRFSAPGVLNEFSSVLKATPFAYTVGISEITKQAMSLTAVT
MNGLVIYTFAGILYFIIYKLSLVAAKLLEMKFKMTSDELKRIKVKMYDIDRIK