Protein Info for DZA65_RS16195 in Dickeya dianthicola ME23

Annotation: tRNA 5-hydroxyuridine modification protein YegQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF01136: Peptidase_U32" amino acids 78 to 347 (270 residues), 287.7 bits, see alignment E=5.6e-90 PF16325: Peptidase_U32_C" amino acids 364 to 445 (82 residues), 79.8 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 84% identical to YEGQ_ECOLI: Uncharacterized protease YegQ (yegQ) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 99% identity to ddd:Dda3937_02814)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y090 at UniProt or InterPro

Protein Sequence (458 amino acids)

>DZA65_RS16195 tRNA 5-hydroxyuridine modification protein YegQ (Dickeya dianthicola ME23)
MFKPELLSPAGTLKNMRYAFAYGADAIYAGQPRYSLRVRNNEFNHQTLAQAISEAHALGK
KFYVVVNIAPHNAKLKTFLRDLQPVVEMNPDALIMSDPGLIMLVRENFPQMPIHLSVQAN
AVNWATVKFWQQMGLSRVILSRELSLEEIEEIRAQVPEMELEIFVHGALCMAYSGRCLLS
GYINKRDPNQGTCTNACRWEYNVQEGKEDAVGNIVHIHEPIAVTQLDAAQAEPTLGIGAP
TDKVFMLEEKQRPGEYMSAFEDEHGTYIMNSRDLRAIQHVERLTTMQVASLKIEGRTKSF
YYCARTAQVYRRAIDDAAAGKPFDPTLLQTLEGLAHRGYTEGFLRRHVHEDYQNYDYGYS
VSDQQQFVGEFTGERRDGLAEVAVKNKFSRGDSVEMMTPGGNIQFTIDTLLNKKGQAIDV
APGDGHTVYLPVPDDIALEYALLLRNLPGTNTRNPHAK