Protein Info for DZA65_RS16190 in Dickeya dianthicola ME23

Annotation: glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 51 to 144 (94 residues), 38.2 bits, E=3.7e-13
• PF00043: GST_C
  • amino acids 182 to 264 (83 residues), 33.2 bits, E=1e-11
• PF13410: GST_C_2
  • amino acids 189 to 261 (73 residues), 65.8 bits, E=6e-22
• PF14497: GST_C_3
  • amino acids 191 to 271 (81 residues), 22 bits, E=3.1e-08

Best Hits

Swiss-Prot: 49% identical to PCPF_SPHCR: Glutathionyl-hydroquinone reductase PcpF (pcpF) from Sphingobium chlorophenolicum

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 95% identity to ddd:Dda3937_02815)

MetaCyc: 52% identical to glutathionyl-hydroquinone reductase YqjG (Escherichia coli K-12 substr. MG1655)
RXN0-7010 [EC: 1.8.5.7]

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.8.5.7 or 2.5.1.18

Sequence Analysis Tools

See A0A385Y021 at UniProt or InterPro

Protein Sequence (320 amino acids)

>DZA65_RS16190 glutathione S-transferase family protein (Dickeya dianthicola ME23)
MSGLINGKWVDGDVAAEEIKGGAFHRQETLFRAAALAPEAGRYQLFVSYLCPWASRTLIY
RNLKALQDVIALSVADPRIGEQGWEFSTPQDAGDKVAPVRYLHQLYTASEAHYTGKVSVP
VLWDRKEGRIVNNESAEIIRLLNHAFNDLTGNRLDFYPAALQPEIDRWNNLIYDNINNGV
YKTGFAKTQAHYDQAVTNLFASLDTVEAHLASHRYLAGDTLTEADWRLFVTLVRFDAAYH
GAFKCNIRRLEDYPHLSGYLRELYQWPGVKETVKLDHIKAGYYSIRWLNPTTIIPKGPQL
NFDRPHQRELVGPSAGIRTA