Protein Info for DZA65_RS16105 in Dickeya dianthicola ME23

Annotation: CoA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF02629: CoA_binding" amino acids 14 to 98 (85 residues), 22.5 bits, see alignment E=1.6e-08 PF13380: CoA_binding_2" amino acids 14 to 130 (117 residues), 138.7 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 69% identical to YCCU_ECOLI: Uncharacterized protein YccU (yccU) from Escherichia coli (strain K12)

KEGG orthology group: K06929, (no description) (inferred from 96% identity to ddd:Dda3937_01702)

Predicted SEED Role

"Succinyl-CoA synthetase, alpha subunit-related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CER3 at UniProt or InterPro

Protein Sequence (137 amino acids)

>DZA65_RS16105 CoA-binding protein (Dickeya dianthicola ME23)
MQDSDIKAVLNQVKTIALVGASENPSRPSHGVMAYLLGQGYRVIPVSPRLAGQTLLGQTA
YASLGDIPEPVDMVDVFRQPDAVFEVAQEAIAIGARVLWLQIGVINEAAAVLAHDAGLTV
VMDRCPKIEIPRLGLEK