Protein Info for DZA65_RS15920 in Dickeya dianthicola ME23

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 195 (189 residues), 146.5 bits, E=1.1e-46
• PF08659: KR
  • amino acids 7 to 167 (161 residues), 39.1 bits, E=1.2e-13
• PF13561: adh_short_C2
  • amino acids 14 to 191 (178 residues), 93.9 bits, E=1.7e-30

Best Hits

KEGG orthology group: None (inferred from 88% identity to dze:Dd1591_2458)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of hexitol degradation (bacteria) (15/18 steps found)
• D-sorbitol degradation II (1/1 steps found)
• L-sorbose degradation (1/2 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

See A0A385Y031 at UniProt or InterPro

Protein Sequence (251 amino acids)

>DZA65_RS15920 SDR family NAD(P)-dependent oxidoreductase (Dickeya dianthicola ME23)
MKTSGNTILITGSTSGIGLGLALRFHEAGNRVIVAGRRNALLDKITRDYPGMEAIELDIA
DAGSVIRASKIAAERYPDLNVVINNAGIMLSENVLDADSLNVAQQTVEINLLGTIRMTYA
FLPQLMKKNDSFIINVSSSLAFVPFPIALTYSATKAAVHAFTAGLRVQLSSTPVRVIELA
PPGVRTTLFGQENEEHAMPLDDFLDETLDLLHADPMPDEIIVERARYLRTAEATGNYENA
LEMLSAWKITD