Protein Info for DZA65_RS15895 in Dickeya dianthicola ME23

Annotation: NAD(P)-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF10727: Rossmann-like" amino acids 1 to 86 (86 residues), 24.1 bits, see alignment E=1.2e-08 PF01408: GFO_IDH_MocA" amino acids 1 to 76 (76 residues), 24.2 bits, see alignment E=2.1e-08 PF03807: F420_oxidored" amino acids 2 to 92 (91 residues), 79.7 bits, see alignment E=9e-26 PF03446: NAD_binding_2" amino acids 2 to 94 (93 residues), 37.2 bits, see alignment E=1.4e-12 PF01488: Shikimate_DH" amino acids 2 to 70 (69 residues), 25.3 bits, see alignment E=6.4e-09 PF07991: KARI_N" amino acids 2 to 73 (72 residues), 26.3 bits, see alignment E=2.4e-09 PF02826: 2-Hacid_dh_C" amino acids 2 to 90 (89 residues), 26.9 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: K06988, (no description) (inferred from 65% identity to ddd:Dda3937_01901)

Predicted SEED Role

"(AJ250023) putative polyketide synthase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y074 at UniProt or InterPro

Protein Sequence (249 amino acids)

>DZA65_RS15895 NAD(P)-binding domain-containing protein (Dickeya dianthicola ME23)
MKIGIIGAGNIGATLAHKLSEKGHVVKIANSRGPETIAELARKVGAVAVERQEAVREVDL
IILSTPFDKHADLAELLRSVPDNVIVIDTSNYYPFRDGDIQDIREGKPESVYASEVYASG
IVNRPLIKAWNAVLSETLKEKGLAAGSPSRIAIPVAGDSPTAKSVALELVNQTGFDAVDA
GTLSESWRQQPGTPAYCTELNAAQLEAALQAADKKRAPLNRDELIREFTSAGDELTHDVI
VKRNRAVTD