Protein Info for DZA65_RS15780 in Dickeya dianthicola ME23

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01547: SBP_bac_1" amino acids 41 to 324 (284 residues), 105.8 bits, see alignment E=4.5e-34 PF13416: SBP_bac_8" amino acids 45 to 354 (310 residues), 155.5 bits, see alignment E=2.6e-49

Best Hits

Swiss-Prot: 50% identical to CYCB_BACSU: Cyclodextrin-binding protein (cycB) from Bacillus subtilis (strain 168)

KEGG orthology group: K10108, maltose/maltodextrin transport system substrate-binding protein (inferred from 95% identity to ddd:Dda3937_02389)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y051 at UniProt or InterPro

Protein Sequence (417 amino acids)

>DZA65_RS15780 extracellular solute-binding protein (Dickeya dianthicola ME23)
MKTKTLTALLLCATAAGQLAAFPVYAAQQLTVWEDIRKSDGIKDAIRDFEKQYNVSVNLQ
EMPYAQQLEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLIAPLKLDQAVQDSFTETSMAA
FRMNNQVYGLPKAVETLVLIYNKEQVSKPLTSLQEWYDFSRRQQAQNTFGLLAKFDQIYY
SWGAIGPMGGYIFGKNDKDPGKNDKGGLNPLDIGLNTPGAVEAVTLLRKFYADKLFPAGI
IGDNGLNAIDSLFTEKKAAAVINGPWAFQPYEAAGIHYGVAPLPLLPDGKPMSSFLGVKG
YVVSTWSKDNALAQRFIDFINQPRYVKVRYQRTGEIPPQKSMIDDPLIKNDEKASAVAIQ
AARAVPMPGIPEMGEVWGPANAALELSMTGKQQPKAALDNAVKQIKMQVEAMQASNQ