Protein Info for DZA65_RS15745 in Dickeya dianthicola ME23

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00356: LacI" amino acids 7 to 52 (46 residues), 65.1 bits, see alignment 7.7e-22 PF13407: Peripla_BP_4" amino acids 80 to 278 (199 residues), 58.6 bits, see alignment E=1.5e-19 PF00532: Peripla_BP_1" amino acids 84 to 325 (242 residues), 60.7 bits, see alignment E=3.4e-20 PF13377: Peripla_BP_3" amino acids 173 to 331 (159 residues), 105.4 bits, see alignment E=7e-34

Best Hits

Swiss-Prot: 45% identical to LACI_ECOLI: Lactose operon repressor (lacI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to dze:Dd1591_1283)

Predicted SEED Role

"Transcriptional repressor of the lac operon" in subsystem Lactose and Galactose Uptake and Utilization or Lactose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1S9 at UniProt or InterPro

Protein Sequence (357 amino acids)

>DZA65_RS15745 LacI family DNA-binding transcriptional regulator (Dickeya dianthicola ME23)
MKSKSATLEDVARHAGVSYQTVSRVLNKSANVSESTRRKVEQSIELLRYVPNRLAQQLVG
KQSMTMGLVTTSLALHAPSQVAAAVKRYANMEGYQVLISMIDENVNHGIQDSINELKSQR
VDKVIINVPLETEEAERIAADNDDILCLFLDVDPYSSVFNVSFNPADGTRASVKYLYELG
HRDVALLAGPAGSVSARLRLKNWLETLDGYGLTPVTVIHGNWDAQSGYASALQMLRETPQ
FSAVLVANDQMALGVLSAFHQNQLTIPGQKSVIGYDDTYESSFFHPALTTVSLDLDRQGK
EAVHRLLNANDSDAQRSSSILPARLVIRNSTGSRLDEQRDLQQIAEELRSIAHRLSQ