Protein Info for DZA65_RS15680 in Dickeya dianthicola ME23

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 33 to 659 (627 residues), 571.8 bits, see alignment E=8.5e-176 PF21305: type_II_gspD_N0" amino acids 33 to 102 (70 residues), 89.2 bits, see alignment E=1.9e-29 PF03958: Secretin_N" amino acids 129 to 190 (62 residues), 54.2 bits, see alignment 2.1e-18 amino acids 196 to 262 (67 residues), 57.9 bits, see alignment E=1.5e-19 amino acids 269 to 401 (133 residues), 58.9 bits, see alignment E=7.1e-20 PF00263: Secretin" amino acids 485 to 652 (168 residues), 168.3 bits, see alignment E=1.7e-53

Best Hits

Swiss-Prot: 92% identical to GSPD2_DICD3: Secretin OutD (outD) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 92% identity to dze:Dd1591_1299)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZZ0 at UniProt or InterPro

Protein Sequence (714 amino acids)

>DZA65_RS15680 type II secretion system secretin GspD (Dickeya dianthicola ME23)
MLGKGIKKSWGWLGLTVLLLGSPYGWAAEFSASFKGTDIQEFINTVSKNLNKTVIIDPTV
RGTISVRSYDMMNEGQYYQFFLSVLDVYGFSVVPMDNGVLKVIRSKDAKSSSIPLANNEQ
PGVGDELVTRVVPLNNVAARDLAPLLRQLNDNAGAGTVVHYEPSNVLLMTGRAAVIKRLV
DIVNTVDKTGDREMITVPLTYASAEDVAKLVNDLNKTDEKNALPSTMLANVVADERTNSV
VVSGEENGRQRAIEMIRQLDRKQVAQGGTKVIYLKYAKALDLIEVLAGNGTSGNRNSSSS
NASRSSSSRTSNSGLNSNNNSSGSTNSSGSSSSSSSSSSSMGFGSTFGSTSSSGGRTIVI
QGKEVTVRAHDQTNSLIITAPPDIMRDLEQVINQLDIRRPQVLVEAIIAEIQDADGLNLG
IQWANKRAGMTQFTNTGIPISTAVIGTDQFRSDGTLTTAYASALGSFNGITAGFYRGNWS
MLLTALSRDSKNDVLATPSIVTLDNMEATFNVGQEVPVLTGSQTTVGSGNNIFNTVERKT
VGIKLRVKPQINEGDSVLLQIEQEVSSVADSNSSTNSSLGATFNTRTVNNAVMVTNGETV
VVGGLLDKTTIESNDKVPLLGDIPWLGSLFRSKSQSVNKRNLMLFLRPTIIRDPGQFQEA
SINKYRSFNNEQQQQRGEGNRVLDNNTLRLSGGNTYTFRQVQSSISAFYQPEGR