Protein Info for DZA65_RS15665 in Dickeya dianthicola ME23

Annotation: type II secretion system major pseudopilin GspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details PF07963: N_methyl" amino acids 3 to 27 (25 residues), 37.6 bits, see alignment 1.1e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 34.7 bits, see alignment 1e-12 TIGR01710: type II secretion system protein G" amino acids 6 to 137 (132 residues), 191.3 bits, see alignment E=6.7e-61 PF08334: T2SSG" amino acids 30 to 136 (107 residues), 129.4 bits, see alignment E=5.8e-42

Best Hits

Swiss-Prot: 96% identical to GSPG_DICCH: Type II secretion system protein G (outG) from Dickeya chrysanthemi

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 97% identity to dze:Dd1591_1302)

MetaCyc: 71% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DE31 at UniProt or InterPro

Protein Sequence (153 amino acids)

>DZA65_RS15665 type II secretion system major pseudopilin GspG (Dickeya dianthicola ME23)
MERRQRGFTLLEIMVVIVILGVLASLVVPNLMGNKEKADRQKAISDIVALESALDMYKLD
NSRYPTTEQGLGALVKKPTTPPEPRNYPQDGYIRRLPQDPWGAEYQLASPGRHGKVDVFS
YGPDGMPDTDDDIGNWNVGNGAHNNGSNGNGNP