Protein Info for DZA65_RS15630 in Dickeya dianthicola ME23

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 116 to 148 (33 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF06750: A24_N_bact" amino acids 20 to 122 (103 residues), 105.7 bits, see alignment E=1.1e-34 PF01478: Peptidase_A24" amino acids 137 to 244 (108 residues), 98 bits, see alignment E=4.3e-32

Best Hits

Swiss-Prot: 87% identical to LEP4_DICCH: Type 4 prepilin-like proteins leader peptide-processing enzyme (outO) from Dickeya chrysanthemi

KEGG orthology group: K02464, general secretion pathway protein O [EC: 2.1.1.- 3.4.23.43] (inferred from 94% identity to ddd:Dda3937_02425)

MetaCyc: 45% identical to prepilin leader peptidase/N-methyltransferase (Pseudomonas aeruginosa)
Prepilin peptidase. [EC: 3.4.23.43]; 2.1.1.- [EC: 3.4.23.43]

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTU6 at UniProt or InterPro

Protein Sequence (283 amino acids)

>DZA65_RS15630 prepilin peptidase (Dickeya dianthicola ME23)
MDLIVFASAFPRIWLTALLLLGLIVGSFLNVVIHRLPAMLERRWQQDARFQLGQPVGAPS
PRYDLCWPPSSCPHCHQRLRVRDNIPLLSWIWLRGRAHCCGGAVSWRYPLIELLCGLSFL
LAGLLWPPGLALLGALLCFGMLLALAAIDARTQLLPDVMTLPLLWGGLLFNLADTFVPIE
QAVVGAVAGYLSLWLIYWAFRLLSGREALGQGDFKLLAALGAWLGWQALPNLVLIASLTG
LVATLLWRRVRRINMQQPLAFGPWLAVGGAVSLVLNALGSWSH