Protein Info for DZA65_RS15605 in Dickeya dianthicola ME23

Annotation: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00106: adh_short" amino acids 10 to 190 (181 residues), 157.7 bits, see alignment E=3.9e-50 TIGR04316: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase" amino acids 12 to 250 (239 residues), 347 bits, see alignment E=3.2e-108 PF13561: adh_short_C2" amino acids 16 to 248 (233 residues), 161.6 bits, see alignment E=3.7e-51 PF08659: KR" amino acids 50 to 158 (109 residues), 29.9 bits, see alignment E=7.5e-11

Best Hits

Swiss-Prot: 66% identical to ENTA_ECOLI: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (entA) from Escherichia coli (strain K12)

KEGG orthology group: K00216, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase [EC: 1.3.1.28] (inferred from 95% identity to ddd:Dda3937_02431)

MetaCyc: 66% identical to 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. [EC: 1.3.1.28]

Predicted SEED Role

"2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28)" in subsystem Iron acquisition in Vibrio (EC 1.3.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CF25 at UniProt or InterPro

Protein Sequence (251 amino acids)

>DZA65_RS15605 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Dickeya dianthicola ME23)
MSVTLDFSGKQVWVTGAGRGIGYDIACRFTEAGATVTGFDRAFSVEPPFRAIELDIGAHA
AVADVCATLLAQTPRLDVLVNGAGILRIGQTEALSQQDWQDCLTVNAGGAFHLFQALIPQ
FQRQRSGAIVSIGSNAAHVPRAGMAAYCASKAALRSLCLTVGLELAPYGVRCNMVSPGST
DTPMQRSLWHSPASEQHTIAGFPEQFKLGIPLGKIARPRDITDAVLFLASDLASHVTLQD
MVIDGGATLGA