Protein Info for DZA65_RS15580 in Dickeya dianthicola ME23

Annotation: enterochelin esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF11806: Enterochelin_N" amino acids 45 to 171 (127 residues), 138.8 bits, see alignment E=1.5e-44 PF00756: Esterase" amino acids 211 to 422 (212 residues), 75.3 bits, see alignment E=7e-25

Best Hits

Swiss-Prot: 87% identical to FES_DICD3: Enterochelin esterase (fes) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 89% identity to dze:Dd1591_1320)

Predicted SEED Role

"Enterobactin esterase" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0I9 at UniProt or InterPro

Protein Sequence (435 amino acids)

>DZA65_RS15580 enterochelin esterase (Dickeya dianthicola ME23)
MPAAQPSGFAATLLSSPQAGEEVWWQQVARLGTPLVEMLDAGQVRVTFLWRDPNGDERHS
AIQRVYADINGVTDHHSTDPQSLERLPATDVWHWSMVIEHDWRGSYSLIPVVTAQLPPVF
SDDESLRDEQQREWWCSLFPSAIADPLSLCLPWGAQLSAAHMPAAPSQQAWRAVDNGSAL
PPDAARLTVFDWQSEQLDNQRRIWLYATGSSDEPAQRPLCLVLDGQRWAEDTPLFSALEA
ETLAGHLPSAVWLFIDAIDGETRCRELPCDAVFWQAVQQELLPLAARLTPFSDDPDRTVV
AGQSYGGLAALYAGLHWPQRFGRVLTQSGSFWWPNLQFITDFELHDTLEPGVLVTELRQG
GRTASPLVIFQEAGRREADIAFVNQQMHEALIAAGHQVHQRVYAGGHDTLCWRGGLIDGF
RWLLSDAGSQATSQN