Protein Info for DZA65_RS15550 in Dickeya dianthicola ME23

Annotation: Fe(3+)-siderophore ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 37 to 63 (27 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 254 to 296 (43 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details PF01032: FecCD" amino acids 46 to 354 (309 residues), 293.7 bits, see alignment E=7.3e-92

Best Hits

Swiss-Prot: 56% identical to FEPD_ECOLI: Ferric enterobactin transport system permease protein FepD (fepD) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 96% identity to ddd:Dda3937_03034)

MetaCyc: 56% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport system permease protein FepD (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DE17 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DZA65_RS15550 Fe(3+)-siderophore ABC transporter permease (Dickeya dianthicola ME23)
MHFLIKRFLSVSSSLSAQTATPAALPRALSSLTGRRIAGIIPCLLLLALICLASLMLGAR
AIAPAVVWHSLTGSLQGPDSTIILQARLPRTLAGMLVGMALGAAGAVMQALTRNPLADPG
ILGVNAGASFAIVLGISFFGITGMASWLGFAWLGVLAAGLMVWIIGTLSGGRVNPIRLTL
AGVALSAVLSGFTSSLTLLNPLAFDQLRLWEAGTLDIRSLGNVAWVTPTVLLGCALAFFA
ARSLNTLSMGEDLATALGTHVMLIRVIAMLAVMLLCGSATALAGPIGFVGLMIPHIARGW
AGPDQRWILIYSLLFAPILLLGADIIGRLLVPGELRVSIVTAFIGAPVLIWLVRQRKS