Protein Info for DZA65_RS15405 in Dickeya dianthicola ME23

Annotation: tripartite tricarboxylate transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 72 (27 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details amino acids 471 to 491 (21 residues), see Phobius details PF01970: TctA" amino acids 20 to 440 (421 residues), 513.6 bits, see alignment E=1.8e-158

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 97% identity to ddd:Dda3937_02113)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZM1 at UniProt or InterPro

Protein Sequence (505 amino acids)

>DZA65_RS15405 tripartite tricarboxylate transporter permease (Dickeya dianthicola ME23)
MDTWSFLMQGFAVAMTPQNLMIALIGCFIGTIVGLLPGLGPINGVAILMPLAFALKLPAE
SALILLATVYLGCEYGGRISSILLNVPGDAGAIMTALDGYPMAQQGKAGVALSISAVSSF
VGSSIAIVGIILFAPLLANWSLAFGPAEYFALMVFAIACLGSMMSHNPLKSFLAALIGLS
MATVGVDANTGVYRFTFDNVHLSDGIQFVVVVIGLFSVSEILLMLEQTGGGQKLTKATGR
MLFNTREGIQCIGATLRSSLLGFFVGILPGAGATIASAMAWMTEKKLSGNSDSFGKGDIR
GVAAPEAANNASACGSFIPMLTLGVPGSGTTAVMMGALTLYNITPGPAMFTEQPDIVWGL
IAAMLIGNLMLLLLNLPMIGLFTRMLAIPMWFLVPAIAAISAVGVYAVHSTTFDLLLMVG
LGVFGYLLRKMNFPMSPLILGFVLGEMLEQNLRRALSISNGELSILWEGRISQILLAMAV
LILLAPPVLKYWRRRRSQLQSVPRT