Protein Info for DZA65_RS15325 in Dickeya dianthicola ME23

Annotation: transporter substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 10 to 252 (243 residues), 305.2 bits, see alignment E=1.8e-95 PF00497: SBP_bac_3" amino acids 27 to 253 (227 residues), 144 bits, see alignment E=2.4e-46

Best Hits

Swiss-Prot: 73% identical to HISJ_ECO57: Histidine-binding periplasmic protein (hisJ) from Escherichia coli O157:H7

KEGG orthology group: K10014, histidine transport system substrate-binding protein (inferred from 98% identity to ddd:Dda3937_00102)

Predicted SEED Role

"Histidine ABC transporter, histidine-binding periplasmic protein precursor HisJ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D208 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DZA65_RS15325 transporter substrate-binding domain-containing protein (Dickeya dianthicola ME23)
MKKMLKFLPLALVFAAGSALAEVPKNIKIGTDPTYAPFESKDASGQLVGFDIDLAKELCK
RIQANCTFVESDFDALIPSLKAKKIDAIISSLSITEKRQQEIAFTDKLYAANARLIAKKG
SPILPTLDALKGKRVGVLQASTQESYANQYWQPKGVDVVAYQNQDLIYADLTAGRIDAAF
QDEVAGSEGFLKQAAGKEYAFAGPAVKDDKLFGVGTGMGLRKNETELKAALDKAFATLRK
DGTYDKLAKKYFDFDVYGE