Protein Info for DZA65_RS15305 in Dickeya dianthicola ME23

Annotation: TIGR01777 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01370: Epimerase" amino acids 4 to 215 (212 residues), 80 bits, see alignment E=2.7e-26 TIGR01777: TIGR01777 family protein" amino acids 4 to 293 (290 residues), 362.4 bits, see alignment E=1.1e-112 PF08338: DUF1731" amino acids 250 to 296 (47 residues), 70.1 bits, see alignment 1.6e-23

Best Hits

Swiss-Prot: 66% identical to YFCH_ECOLI: Epimerase family protein YfcH (yfcH) from Escherichia coli (strain K12)

KEGG orthology group: K07071, (no description) (inferred from 95% identity to ddd:Dda3937_04213)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D795 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DZA65_RS15305 TIGR01777 family protein (Dickeya dianthicola ME23)
MKLLITGGTGLIGRHLIARLLSLSHQITVVTRSVERARRLWGAQVDYWRGLEEQTSLDGF
DGVINLAGEPIADKRWTKAQKARLCQSRWDITHQLAQLIRHSQTPPAVFLSGSAVGYYGD
QGQALVTEDEPPHDDFTHELCARWEALAQEAESDQTRVCLLRTGVVLSAEGGALAKMLPV
FRLGLGGPIGSGKQYLPWIHIDDMTNAILYLLDNPILSGPFNMVSPYPVRNEKFSAMLAS
ALDRPGFVRTPGWVLRIVMGEAATLLLGGQRAIPQRLEKAGFGFRFFELEEALKDLLRPR
AS