Protein Info for DZA65_RS15300 in Dickeya dianthicola ME23

Annotation: GSH-dependent disulfide bond oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02798: GST_N" amino acids 4 to 81 (78 residues), 43.6 bits, see alignment E=9.4e-15 PF13417: GST_N_3" amino acids 7 to 83 (77 residues), 34.3 bits, see alignment E=7.2e-12 PF13409: GST_N_2" amino acids 10 to 81 (72 residues), 46.2 bits, see alignment E=1.8e-15 PF13410: GST_C_2" amino acids 128 to 192 (65 residues), 29.4 bits, see alignment E=2.1e-10 PF00043: GST_C" amino acids 131 to 197 (67 residues), 47.6 bits, see alignment E=4.9e-16 PF14497: GST_C_3" amino acids 133 to 198 (66 residues), 25.2 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 72% identical to YFCG_ECOLI: Disulfide-bond oxidoreductase YfcG (yfcG) from Escherichia coli (strain K12)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 94% identity to dze:Dd1591_1381)

MetaCyc: 72% identical to disulfide bond oxidoreductase YfcG (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Probable glutathione S-transferase (EC 2.5.1.18), YfcG homolog" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZJ7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>DZA65_RS15300 GSH-dependent disulfide bond oxidoreductase (Dickeya dianthicola ME23)
MIDVYYAPTPNGHKITLFLEEAQLPYQLHHVDIGAGDQFKPEFLAISPNNKIPAIVDQQP
ADRGAPIGLFESGAILLYLAEKSGKLLSTDVRERAATLQWLFWQVAGFGPMLGQNHHFNH
YAPQPVPYAIDRYQKETERLYGVLNSQLRHHAWLAGDGYSIADIATYPWVVSHDRQRIDL
DAFPAVKSWFERIRERPATQRAYQLAAKA