Protein Info for DZA65_RS15120 in Dickeya dianthicola ME23

Annotation: DUF935 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 340 to 357 (18 residues), see Phobius details PF06074: Portal_Mu" amino acids 62 to 404 (343 residues), 314 bits, see alignment E=7.4e-98

Best Hits

KEGG orthology group: None (inferred from 54% identity to bvi:Bcep1808_1306)

Predicted SEED Role

"Mu-like prophage FluMu protein gp29"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C2U3 at UniProt or InterPro

Protein Sequence (525 amino acids)

>DZA65_RS15120 DUF935 domain-containing protein (Dickeya dianthicola ME23)
MAQIVDQFGRPFNKEVLSGPQTARTAQIQRHFPDHPSRGLDIRRLPRILEAAERGDIAAQ
ADLFEDMVEKDGHIFSEMAKRKNALLGLDWSIEPPVNASEAEKSLAAMVTEWMHGIPDIH
DLILNAADAIGHGFSAQEIEKWDNEGNVWLPIKTVLRPHRWFCTNPEIDDTVRLADGTMN
GAELWPFGWMVHAHNAKSGYIAQAGLYRVLVWPYLFKNFSLRDFAEFLEIYGLPPRIGTY
MASATEEEKNRLLHALVTLGHDAAGIIPEGTNIRFESAADGQAATFMSMIDWCERTASKV
ILGGTLTSQADGKTATNALGNVHNEVRHDILVADARQLEGFFSNVISMLLAINGYAVSRR
RQPRFVFDTRDIADISTFSAGIKTLVDAGMETIPLSWIHQKVGIPIPKEGEPTLMPATPT
PTTALSSRTSPYRSFAALSTTAVDDISDPAQVALDNARSTPEAINDAMQALIAPLVAALQ
NGQTPDDALDIIAASYPALDDTQLQQLLSQALFVADVWGHLNADK