Protein Info for DZA65_RS15040 in Dickeya dianthicola ME23

Annotation: phage baseplate assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR01644: phage baseplate assembly protein V" amino acids 12 to 179 (168 residues), 64 bits, see alignment E=6.8e-22 PF06890: Phage_Mu_Gp45" amino acids 21 to 86 (66 residues), 89.8 bits, see alignment E=4.3e-30

Best Hits

KEGG orthology group: None (inferred from 57% identity to sgl:SG0789)

Predicted SEED Role

"Prophage baseplate assembly protein V"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C3S8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DZA65_RS15040 phage baseplate assembly protein (Dickeya dianthicola ME23)
MWDNVEAKIRRAMNGVRQAFRVRLSRVNSAGPVQTFQANGLAGEQIQDAELFQHYGFTSN
PPAGTMGIVIPLGGRTSHSVVVATESASYRIKALLSGEVAIYTNEGAAITLKKGRIITVD
CDEYQVNCKKYIVNANEEADFNTPLLKASEEITDKTSTLSRVREIYDSHDHPGDSGGTTG
APNQSM