Protein Info for DZA65_RS14870 in Dickeya dianthicola ME23

Annotation: hydrogenase nickel incorporation protein HypB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR00073: hydrogenase accessory protein HypB" amino acids 147 to 357 (211 residues), 307.2 bits, see alignment E=2.8e-96 PF02492: cobW" amino acids 177 to 336 (160 residues), 86.2 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 84% identity to dze:Dd1591_1417)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CT75 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DZA65_RS14870 hydrogenase nickel incorporation protein HypB (Dickeya dianthicola ME23)
MCTTCGCGEGERRIEGDEQAHSHHHPHTHDHHHEHDHHPEHDHHHEHDDISAAPGVIIHH
HHYYYHHGDVHHHYHGAARPQAAGHAHDHHDHQHHDHEQHDHAEHHHTHKHAQPEARFQP
VEREQHLHYGQGAAGTHAPGLGQQRLLQIEMDVLSKNNQLAVHNREHFDASQILALNLVS
SPGSGKTTLLTSTLHLLRERVPCAVIEGDQQTTNDAERIRATGVPAIQVNTGKGCHLDAQ
MVHDAMHRLQLPAHSLLFIENVGNLVCPAGFDLGERHKVAVLSVTEGEDKPLKYPHMFAA
ASLMIINKTDLLPYLDFDLEACVANARRVNPHIEVIALSARTGEGIEAWLAWLEAQSLGA
ELAQAPSQPSLLSGA