Protein Info for DZA65_RS14760 in Dickeya dianthicola ME23

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 59 to 78 (20 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 100 to 294 (195 residues), 240 bits, see alignment E=9.7e-76 PF00528: BPD_transp_1" amino acids 134 to 292 (159 residues), 77.3 bits, see alignment E=6.4e-26

Best Hits

Swiss-Prot: 44% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 90% identity to ddd:Dda3937_01846)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D9M0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>DZA65_RS14760 nitrate ABC transporter permease (Dickeya dianthicola ME23)
MKTQAQILSIVPEHTAMPEQTDVVTDATVMTLPEATTAPESAALPRAVWRPRLSQWLSRL
LPGGVGMILLLAVWQVAALSSKGFPTPWQTWLAAQSIFADPFYVAGPNDQGIGWNVLASL
KRVGIGFGLAALVGIPAGFLIGRFRFMAAMFNPIVSLLRPVSPLAWLPIGLLLFQRAEPA
SSWTIFICSIWPMILNTAEGVRQIPQDYLNVARVLKLSEFTIMRKILLPAVLPNVLTGVR
LSIGIAWLVIVAAEMLTGGIGIGFWIWNEWNNLNVPNIIIAILVIGVVGLLLEQGLMLLA
KRFSYETR