Protein Info for DZA65_RS14735 in Dickeya dianthicola ME23

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to FMNRE_PSEAE: NAD(P)H-dependent FMN reductase PA1204 (PA1204) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_01851)

MetaCyc: 32% identical to quinone reductase (Pseudomonas putida KT2440)
RXN0-5330 [EC: 1.6.5.9]

Predicted SEED Role

"probable NADPH:quinone oxidoreductase( EC:1.6.99.2,EC:1.8.1.6 )"

MetaCyc Pathways

NADH to cytochrome bd oxidase electron transfer II (2/2 steps found)
NADH to nitrate electron transfer (2/2 steps found)
nitrate reduction VIIIb (dissimilatory) (2/2 steps found)
superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
NADH to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
mitochondrial NADPH production (yeast) (3/5 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y306 at UniProt or InterPro

Protein Sequence (181 amino acids)

>DZA65_RS14735 NAD(P)H-dependent oxidoreductase (Dickeya dianthicola ME23)
MSHIKLLGIAGSLRKVSSNRGLLRAAQSVLPAGVTLEIADLLDVPFYNADLTEVPASVQR
IARQASEADGFVFACTEYNYSMAPALKNILDWISRLPDTSILNEKPAALMGAGGGMGTSR
SQYHLRQTCVYLNLHPLNKPEVFANAFAGGFDDQGNLKDEKITALIADQMNALADAIARR
K