Protein Info for DZA65_RS14430 in Dickeya dianthicola ME23

Annotation: P-type DNA transfer ATPase VirB11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR02788: P-type DNA transfer ATPase VirB11" amino acids 21 to 325 (305 residues), 301.4 bits, see alignment E=3.1e-94 PF00437: T2SSE" amino acids 160 to 276 (117 residues), 69.7 bits, see alignment E=9.8e-24

Best Hits

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 88% identity to eca:ECA1613)

Predicted SEED Role

"ATPase provides energy for both assembly of type IV secretion complex and secretion of T-DNA complex (VirB11)" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFM4 at UniProt or InterPro

Protein Sequence (342 amino acids)

>DZA65_RS14430 P-type DNA transfer ATPase VirB11 (Dickeya dianthicola ME23)
MNAENLSLDFMKNQLFDEFLPLAGLTEIAINRPGEIHTKINGRWQKHDSPVTLRQCHAFA
KALASWNEDNIDDTSPILSATLGSGERVQTIIPPACERNTVSITLRKPSFEQKTHQSWID
AGFYNRIAGKERNEGKDDELTRCYNNGDIPHFIEKAVEYGKTIFIVGETGSGKTTYMKTL
LHYIPPHLRLTTIEDNPEIRFYHHANYVHLFYPADAGEDAIVTPGRLIRANYRMNPDRIL
LAEIRGREAWDALKIIGSGHEGLITSMHAGSPEECIEGIIDRCYEHPDCQNIPFAVLLRK
VLNSVDVIVSVDIHGDIRRMGAIYFKHLHLNSMKEVFNEANR