Protein Info for DZA65_RS14425 in Dickeya dianthicola ME23

Annotation: TrbI/VirB10 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 57 to 78 (22 residues), see Phobius details PF03743: TrbI" amino acids 217 to 398 (182 residues), 151.9 bits, see alignment E=9.4e-49

Best Hits

KEGG orthology group: K03195, type IV secretion system protein VirB10 (inferred from 72% identity to ddc:Dd586_1453)

Predicted SEED Role

"Inner membrane protein forms channel for type IV secretion of T-DNA complex (VirB10)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C408 at UniProt or InterPro

Protein Sequence (413 amino acids)

>DZA65_RS14425 TrbI/VirB10 family protein (Dickeya dianthicola ME23)
MTDKPIPETTEKTVADLEAEARERARSAMASQAPEQNTPPGQPKVTRFKKASSRRTLLVS
LLSLGALIALALGGDRFLVALKQSNDKSVETPAPPSASTGQHERKNLGMDNNPFGLFGQD
KQETATDNPPIQTAPSSEPPALNKAAALVDGSSSAADSTQRGNTQASQTAPSGTQHNQSN
QSKDAPATTSGTEANNANPGVAKVTSVRRLGLDPNLYLPVDRYVPCSMMRRFVSDVGGRI
SCLIGEDVYSANHYVKLLPAGTVARGFYRTGALQHGRSRMFVIWTELRTPEPGSLQIPLI
DTEVTGPLGEAGISGWIDTHFWERFGNALMLSTVQDVAAAASDSAPGKDRNTDYTENTRA
AASEMAKTALENSINIPPTMYLNQGDVIGIMTGTDIDFSSVYQLRLKKRWYER