Protein Info for DZA65_RS14400 in Dickeya dianthicola ME23

Annotation: type IV secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 158 to 184 (27 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details PF04610: TrbL" amino acids 40 to 251 (212 residues), 140.2 bits, see alignment E=4.5e-45

Best Hits

KEGG orthology group: K03201, type IV secretion system protein VirB6 (inferred from 85% identity to ddd:Dda3937_02750)

Predicted SEED Role

"Integral inner membrane protein of type IV secretion complex (VirB6)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C9I2 at UniProt or InterPro

Protein Sequence (346 amino acids)

>DZA65_RS14400 type IV secretion system protein (Dickeya dianthicola ME23)
MSGGMFVGMNNTITDGLHAVLRGQTSVYGDMVSVIAVSSFTLFVTYRGYQTLTGKLQTPV
EDVIWDVGRMLLIMTFVLNLDGWLDLAISAINGLTDGVSGDDNVWVLLDTVWAKAQTIGQ
KLYQQDDSTYVKLNGGIAQLLVWGGAIVTLLFGSAVNLLAGIIIVLMTTTAPLFIFCLLY
GFLIPMFNNWLKIIFTVILTIMFSALSIRIVINYLNGLLDKAVNFADSANIITLGVQCCV
AGVISGVIIWFSAKIANALGGVAVQAALQGAAMGGLRGLAKPSSDAAKPVMKAGAAGARL
AAKAGVNAATATGSLIAAGTNKALSAWQKRAASIDSMKRFNQQRNR