Protein Info for DZA65_RS14125 in Dickeya dianthicola ME23

Annotation: pectate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF22842: Pel9A-like_beta_helix" amino acids 42 to 326 (285 residues), 320.6 bits, see alignment E=1e-99 PF13229: Beta_helix" amino acids 134 to 313 (180 residues), 66.6 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 98% identical to PLYL_DICD3: Pectate lyase L (pelL) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_02794)

Predicted SEED Role

"Pectate lyase L precursor (EC 4.2.2.2)" (EC 4.2.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.2.2

Use Curated BLAST to search for 4.2.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYY5 at UniProt or InterPro

Protein Sequence (425 amino acids)

>DZA65_RS14125 pectate lyase (Dickeya dianthicola ME23)
MKYLNCFISTGLAAFFLVNSTSVLAADCSSDLTSGISTKRIYYVAPNGNSSNNGNSFNSP
MSFSTAMAAVNPGELILLKPGTYTIPYTQGKGNTITFNKSGKEGAPIYVAAANCGRAVFD
FSFPDSQWVQASYGFSVTGDYWYFKGIEVTRAGYQGAYVIGSHNTFENTAFHHNRNTGLE
INNGGSYNTVINSDAYRNYDPKKNGSMADGFGPKQKQGPGNRFIGCRAWENSDDGFDLFD
SPQTVVIENSWAFRNGVNYWNDSAFAGNGNGFKLGGNQAVGNHRITRSVAFGNVSKGFDQ
NNNAGGVTVINNTSYKNGINYGFGSNVQSGQKHYFRNNVSLSASVTVSNADAKSNSWDTG
PAASASDFVSLDTSLATVSRDNDGTLPETSLFRLSANSKLINAGTKESNISYSGSAPDLG
AFERN