Protein Info for DZA65_RS14085 in Dickeya dianthicola ME23

Annotation: flagellar motor stator protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 50 (17 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 385.9 bits, see alignment E=5e-120 PF20560: MotA_N" amino acids 4 to 93 (90 residues), 109.4 bits, see alignment E=8.5e-36 PF01618: MotA_ExbB" amino acids 125 to 236 (112 residues), 47.6 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 72% identical to MOTA_ECOLI: Motility protein A (motA) from Escherichia coli (strain K12)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 98% identity to ddd:Dda3937_02783)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZ90 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DZA65_RS14085 flagellar motor stator protein MotA (Dickeya dianthicola ME23)
MLVILGYLVTIGSILGGYLIVGGELGALYQPSELLIIAGSAVGAFIVGNNGKAIKATLKA
LPTLLKGSQYTKAVYMDLMAVLFRLMAKSRQQGMLSLEFDIDNPKESEIFSNYPRILSDD
YIVEFVTDYLRLMVSGNMNAFEIETLMDEEIETVEHEVEVPATSLNLMGDGLPAFGIVAA
VMGVVHSLAFVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLASLLRQKNSEKLKVLQC
IKVTLLSSLNGYAPQIAVEFGRKTLYSAVRPSFTEMEEHIRNVKAPAQQASENDA