Protein Info for DZA65_RS14080 in Dickeya dianthicola ME23

Annotation: flagellar motor protein MotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 54 (54 residues), see Phobius details PF13677: MotB_plug" amino acids 9 to 64 (56 residues), 73 bits, see alignment 1.1e-24 PF00691: OmpA" amino acids 156 to 254 (99 residues), 46.8 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 66% identical to MOTB_ECO57: Motility protein B (motB) from Escherichia coli O157:H7

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 97% identity to ddd:Dda3937_02782)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CI41 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DZA65_RS14080 flagellar motor protein MotB (Dickeya dianthicola ME23)
MKHQHPIIRKKRKSGHAAHHGGSWKIAYADFMTAMMALFLVMWLIAISSPSQLAQIAEYF
RTPLKIAITSGPKISDASNPIPGGGSDPTQQEGDVKRQIDTMDGRLEEIKLNKLRERLDQ
LIDADPRLKALRPHLLIEMVDEGLRIQIIDSNNRPMFKTGSAQVEPYMSDILRAIAPILN
DIPNKISLSGHTDDAQYAMGERGYSNWELSAERANASRRELIIGGLAEGKVLRVVGMADT
MNLKQAKGGSDAINRRISLVVLNKQAQENIERENAESSAINIDKIENLQNMGVDKSKPAT
APADNGNSTATPPPETNGTPASGSTVAPAQAPATTAPASGANGAPTTGRRLPTTALPAAP
DSQATPSSTSRDSQQR