Protein Info for DZA65_RS14040 in Dickeya dianthicola ME23

Annotation: flagellar type III secretion system protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 91 to 118 (28 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 187 to 214 (28 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 353 (346 residues), 455 bits, see alignment E=9e-141 PF01312: Bac_export_2" amino acids 8 to 347 (340 residues), 445.8 bits, see alignment E=5.6e-138

Best Hits

Swiss-Prot: 66% identical to FLHB_YEREN: Flagellar biosynthetic protein FlhB (flhB) from Yersinia enterocolitica

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 97% identity to ddd:Dda3937_02774)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGE3 at UniProt or InterPro

Protein Sequence (383 amino acids)

>DZA65_RS14040 flagellar type III secretion system protein FlhB (Dickeya dianthicola ME23)
MADDSDLEKTEAPTPQRTEKAREEGQIPRSRELTSVFMLIAGLAILWGSGSGMAGRLTDM
MAKGLIFDHNFISDERLIIAHVGSLIKQAALALVPILFGLVLVALAAPVLLGGLIFSTKA
ISFDFGKMNPLSGLKRMFSTHVLAELFKAILKAIIVGCITFWFLQHNWNSMLHLVSEPLG
SAIKDALNIALLCCFWVILGLFPMVAFDVGWQIWSHIKRLRMSKQEIRDEYKEHEGDPHI
KGRIRQQQRAIAQRRMMADVPKADVIVTNPTHYAVALKYDEKKMHAPKVLAKGADQIALR
IRELGSEHRIPILEAPPLARALYRHTEIGHHIPTGLYAAVAEVLSWVYQLKRWKREGGLI
PRKPKNLPVPDALDFVKEKTTDG