Protein Info for DZA65_RS14035 in Dickeya dianthicola ME23

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 311 to 327 (17 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 22 to 691 (670 residues), 928.4 bits, see alignment E=1.2e-283 PF00771: FHIPEP" amino acids 31 to 682 (652 residues), 894.3 bits, see alignment E=2.7e-273

Best Hits

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 98% identity to ddd:Dda3937_03965)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYW7 at UniProt or InterPro

Protein Sequence (695 amino acids)

>DZA65_RS14035 flagellar biosynthesis protein FlhA (Dickeya dianthicola ME23)
MANLASLLRLPGNMKGSQWQILAGPVLILLILSMMVLPLPPFVLDLLFTFNIALSIMVLL
VAMFTQRTLDFAAFPTILLFSTLLRLSLNVASTRVILMDGHTGAGAAGRVVEAFGHFLVG
GNFAIGIVVFIILVLINFMVITKGAGRIAEVGARFTLDGMPGKQMAIDADLNAGLIGEDE
AKKRRSEVTQEADFYGSMDGASKFVRGDAIAGLMIMAINIIGGLLVGVVQHDMVLGQAVE
NYTLLTIGDGLVAQIPSLVISTAAGVIVTRVSTDQDVGQQMVTQLFNNPHVMILSAGVLG
LIGLVPGMPNFVFLLFTAALLGLAWWTKKEENKAAFAATEAAAAVPAATQVVEASWSDVQ
LEDPLGMEVGYRLIPMVDFQQNGELLGRIRSIRKKFAQEMGFLPPVVHIRDNLDLQPASY
RILMKGVEIGSGEAHPGRWMAINPGNAVGTLPGDLAKDPAFGLPAVWIESALKEQAQTQG
YTVVEASTVVATHLNHLLSLHASELFGRQEAQQLMDRVSQEMPKLTEDFIPGVVTLTTLH
KVLQNLLSEQVSIRDMRTVIETLAEQAPVQTDPYELTTAVRISLGRAITQQWFPGDTELQ
VIGLDSALERLLLQALQGGGGLEPGLSDRLLEQAKQALQRQEMLGAPPVLLVNHALRGLL
SRFLRRSLPQIAVLSNLEISDSRQIRMTSMIGESS