Protein Info for DZA65_RS13985 in Dickeya dianthicola ME23

Annotation: flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 136 (133 residues), 165.2 bits, see alignment E=3.4e-52 amino acids 145 to 243 (99 residues), 98.9 bits, see alignment E=4.9e-32 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 259 (256 residues), 388 bits, see alignment E=2.1e-120 PF00460: Flg_bb_rod" amino acids 7 to 35 (29 residues), 40.3 bits, see alignment (E = 3.7e-14) PF22692: LlgE_F_G_D1" amino acids 96 to 159 (64 residues), 96.8 bits, see alignment E=9.6e-32 PF06429: Flg_bbr_C" amino acids 216 to 260 (45 residues), 71.7 bits, see alignment 4.1e-24

Best Hits

Swiss-Prot: 81% identical to FLGG_SALTI: Flagellar basal-body rod protein FlgG (flgG) from Salmonella typhi

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 98% identity to dze:Dd1591_1558)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMJ9 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DZA65_RS13985 flagellar basal-body rod protein FlgG (Dickeya dianthicola ME23)
MIRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPGAQSSEQT
TLPSGLQLGTGVRPVATERIHTQGAFSETGNVKDLAIKGAGFFQVLMPDGTTSYTRDGSF
QQDSNGQLVTSSGFQVQPAITIPANSSNLTVGRDGVVTVTQQGQVAPVQIGQLNLAMFIN
EAGLENLGENLYAETASSGAPTQSTPGLNGAGLIYQKFVETSNVNVAEELVSMIQTQRAY
EINSKAISSTDQMLQKLTQL