Protein Info for DZA65_RS13965 in Dickeya dianthicola ME23

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 3 to 370 (368 residues), 258.6 bits, see alignment E=7.2e-81 PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 29 bits, see alignment (E = 1.2e-10) PF21158: flgK_1st_1" amino acids 339 to 406 (68 residues), 36.7 bits, see alignment E=5.3e-13 amino acids 415 to 503 (89 residues), 52.5 bits, see alignment E=6.4e-18 PF06429: Flg_bbr_C" amino acids 585 to 636 (52 residues), 31.5 bits, see alignment 2.2e-11

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 94% identity to ddd:Dda3937_02212)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y035 at UniProt or InterPro

Protein Sequence (640 amino acids)

>DZA65_RS13965 flagellar hook-associated protein FlgK (Dickeya dianthicola ME23)
MSNLINTGMSGLSAAQAALSTVSNNISNQAVTGYSRQNALLAQNNGTNISAGYIGNGVTV
VSINRDYNDFVAKQLRSAQTTSSSTTSYYDQISKIDNLLSSSSSSLSTTIQDFFKNLQNL
TSNSSDSSVRQTVLGKAGALVNQFKITDQYLRDMDSNISGEISITVTQINTYAKQIADIN
DQIVRLKGANNGASPNDLLDQRDNLVNDLNKLVGVDVAVQDGDVYNISLKNGLNLVQGKS
YNTLIATPSSTDPARTTVSYNDAIAGASEVKESTITGGSLGGLLSFRSSTLDSARNQLGQ
MALAFTDAFNQQHKAGFDLNNAQGEDFFGVGSSVTLKSAKNTSATELTSSYLSDTYSLQY
NGASWNVTRSDGTAASSTLSGSALSFDGFTIDISGSAASGDTFNFKVSPGQSSISQTAPT
GSTSAASLARNDTNYIKASDYSVKFVGPSASDWSITRSSDGADLSSSATYTTASGSTPAS
LIFDGMKLDIAGTPAAKDLFTVKGVRDVVVDMSVKVTDSSKIAAAGASLTSAGGGVSDNT
NAKALLNLQTVKVVENKSSISQAYASLVGDIGNKTSTAKVTDTSQKNVVSQLTTEQQSVS
GVNLDEEYGDLVRFQQYYMANAKVIQTASTIFDALLAIRS