Protein Info for DZA65_RS13940 in Dickeya dianthicola ME23

Annotation: flagellar biosynthetic protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 36 to 104 (69 residues), 82.9 bits, see alignment E=6.6e-28 PF04347: FliO" amino acids 48 to 130 (83 residues), 78.2 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 60% identical to MOPB_PECCC: Protein MopB (mopB) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 96% identity to ddd:Dda3937_02217)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGG4 at UniProt or InterPro

Protein Sequence (138 amino acids)

>DZA65_RS13940 flagellar biosynthetic protein FliO (Dickeya dianthicola ME23)
MTGTAQQTVSTIQQPPAAAESVISGGALLSQIGTALCGVLLLILLVAWLLRKLGIAPQVK
NSNVMKVVSSCAVGQRERIVIVEIDDTWLVLGVTAQQITHLHTLPARPVGNAVSAEKIAP
ADFLQFLKKATTRPEKTE