Protein Info for DZA65_RS13925 in Dickeya dianthicola ME23

Annotation: flagellar basal body-associated protein FliL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 35 to 35 (1 residues), see Phobius details PF03748: FliL" amino acids 60 to 160 (101 residues), 79.9 bits, see alignment E=9.6e-27

Best Hits

Swiss-Prot: 60% identical to FLIL_SALTY: Flagellar protein FliL (fliL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02415, flagellar FliL protein (inferred from 94% identity to ddc:Dd586_1532)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>DZA65_RS13925 flagellar basal body-associated protein FliL (Dickeya dianthicola ME23)
MATSNKKAQSGGNKRSLWLILLIVIALAATAAAGAGWWLLSHKKAETAASEPPPPPAPVF
MPLDTFTVNLLSPDNNPDRVLYVGITLRVPDESTRARLTNYLPEIRSRLIMLFSRQSSSV
LATEQGKQKLVEDIKQVLSPPLVPGQPNQVVSDVLFTAFILR