Protein Info for DZA65_RS13885 in Dickeya dianthicola ME23

Annotation: flagellar protein FliT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF05400: FliT" amino acids 23 to 106 (84 residues), 72.9 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 97% identical to FLIT_DICCH: Flagellar protein FliT (fliT) from Dickeya chrysanthemi

KEGG orthology group: K02423, flagellar protein FliT (inferred from 97% identity to ddd:Dda3937_02228)

Predicted SEED Role

"Flagellar biosynthesis protein FliT" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGH4 at UniProt or InterPro

Protein Sequence (120 amino acids)

>DZA65_RS13885 flagellar protein FliT (Dickeya dianthicola ME23)
MENLSPLLIEYQGLLKLIRNIKSMALNGLWDDVVEQEIVYIQSIERISQITVPANIPSTV
QLQFRQLLQDILDTESQVKELLQNRMQELAVLIQQSQNQKSINSTYAEFSNDILPGKPQP