Protein Info for DZA65_RS13855 in Dickeya dianthicola ME23

Annotation: carbamoyl-phosphate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF07478: Dala_Dala_lig_C" amino acids 130 to 256 (127 residues), 26.5 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03422)

Predicted SEED Role

"putative carbamoyl-phosphate-synthetase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZ09 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DZA65_RS13855 carbamoyl-phosphate synthase small subunit (Dickeya dianthicola ME23)
MSTIDALMLDAGFSALPLLEACLEQGVAIGVCSGKPGDPGHVRATRSIVEDYSDKEAILG
IVRKENIKAILPGVTDVSYETGAWVAESLGMPGFDSVETTTILLKKDAFRAYAQRKGLPI
PKAVRDIESVGQLSYPILVKPVDAYSGLGISQVQREQDILPAYQSAASASVSGQVVIEEF
KQGSLHSHSAFIRNGEIVCEFFVDEYCTVYPYQVNSSCVAHQMSEALKNAVSDCINSIVA
DLKLCDGLLHTQFIVNGDDFWLIELTRRCPGDLYCQLIRYSTDIPYAEYFVAPFLSLPST
FANKRPAARHYVARHTVSVAEKTIFNALRYHQLPGELLESVVLKKSGEVLNPAPGDRAAV
VFMTFDDKAHLLKNTGNLKYHLVVSHSFLGKEK