Protein Info for DZA65_RS13835 in Dickeya dianthicola ME23
Annotation: RNA polymerase sigma factor FliA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to FLIA_YEREN: RNA polymerase sigma factor FliA (fliA) from Yersinia enterocolitica
KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 98% identity to dze:Dd1591_1590)MetaCyc: 83% identical to RNA polymerase sigma factor FliA (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CDM3 at UniProt or InterPro
Protein Sequence (240 amino acids)
>DZA65_RS13835 RNA polymerase sigma factor FliA (Dickeya dianthicola ME23) MSELYTAEGTMDKNSLWKRYVPLVRHEALRLQVRLPASVELDDLLQAGGIGLLSAVERYD SLQGTAFTTYAVQRIRGAMLDELRSRDWAPRSVRRNAREVAQAMQQAEQSLGRAPTEQEV AQTLNISLEEYRQILLDTNNSQLFSYDEWREEHGDSAEALLEGNEEANPLNQLMDVNLRQ RVMDAIDNLPEREKMVLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRAKLMSDV