Protein Info for DZA65_RS13820 in Dickeya dianthicola ME23

Annotation: phosphate starvation-inducible protein PhoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF02562: PhoH" amino acids 56 to 261 (206 residues), 257.7 bits, see alignment E=1e-80 PF13604: AAA_30" amino acids 62 to 216 (155 residues), 28.1 bits, see alignment E=2.5e-10 PF13245: AAA_19" amino acids 71 to 215 (145 residues), 30.7 bits, see alignment E=4.8e-11

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 99% identity to ddd:Dda3937_03416)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0N0 at UniProt or InterPro

Protein Sequence (262 amino acids)

>DZA65_RS13820 phosphate starvation-inducible protein PhoH (Dickeya dianthicola ME23)
MGRQKAVIKARREAKRVIRRESRSHRQREEDSVTSLVQLGGIEAIGMARESRDASMIEAR
TPAQEHYLSAIENKQLIFATGEAGCGKTFLSAAKAAEALLHKEVERIIVTRPVLQAEEDL
GFLPGDIAEKFAPYFRPVYDVLQRRLGSSFLQYCLRPEIAKVEISPFAYMRGRTFENAVV
ILDEAQNVTVSQMKMFLTRLGENVTVIVNGDITQCDLPVGVKSGLRDALERFTEDGMVGI
VTFGKEDCVRSELCQRTLVAYS