Protein Info for DZA65_RS13810 in Dickeya dianthicola ME23

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 185 to 211 (27 residues), see Phobius details PF02203: TarH" amino acids 1 to 99 (99 residues), 38.1 bits, see alignment E=3e-13 PF12729: 4HB_MCP_1" amino acids 1 to 181 (181 residues), 68.5 bits, see alignment E=1.1e-22 PF00672: HAMP" amino acids 207 to 256 (50 residues), 23.4 bits, see alignment 1.2e-08 PF00015: MCPsignal" amino acids 323 to 478 (156 residues), 150.2 bits, see alignment E=1e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 95% identity to ddd:Dda3937_03415)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCX9 at UniProt or InterPro

Protein Sequence (534 amino acids)

>DZA65_RS13810 HAMP domain-containing protein (Dickeya dianthicola ME23)
MTIVKKLAIAISIFSLALISVGGFGLHSLSQSKDRLEYVMTNTLPSLDNLVKSNNALNDA
RSDLALIFLTREEQQRNTLKRALDDSLASVEKLNAIYKKDLISDDKDIQLANDNLQYLSD
FRAAKDKLFQQSQTDTQAAEKAFASQGYVTLAQEKLVKGFQDQYNYNVGLAGGLQEQNTT
SFKQAFFGLVGLIVVALLAAGTLSTVIISYVRTSLNALRQTLIAVSENLDLTLQADTRKN
DEIGQTSSAFNNLIQRFSTVLADVRSASESVSTASGEIAAANEDLSSRTEEQASSLAQTA
ASMHEISSTIESNVDNTAQANRLGQQASVAVQHGDEAVQRMMHAMEEIAHGSAKVADITN
LIEGIAFQTNILALNAAVEAARAGEHGRGFAVVAGEVRTLSQRSSSAAKEIKTLIDSAIA
AVQHGAVQADEVRDAISNVKGVIQNVSSLVNEVSLASEEQSRGIAQINTAINQMEAVTQQ
NAAMVEQASSAADSLNEQATKLRQSVETFKLQGNAHFIDMHSMNDIHPLRLGNH