Protein Info for DZA65_RS13780 in Dickeya dianthicola ME23

Annotation: GhoT/OrtT family toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 60 (25 residues), see Phobius details PF10753: Toxin_GhoT_OrtT" amino acids 7 to 61 (55 residues), 82.7 bits, see alignment E=9.3e-28

Best Hits

Swiss-Prot: 41% identical to ORTT_ECOL6: Orphan toxin OrtT (ortT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 90% identity to ddc:Dd586_1561)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CC24 at UniProt or InterPro

Protein Sequence (61 amino acids)

>DZA65_RS13780 GhoT/OrtT family toxin (Dickeya dianthicola ME23)
MSHHHLWEMIRTLYFLGLSVSVLFTFFMSKDNSLTMRFLASILIGATWPLSFPVVIVFSF
F