Protein Info for DZA65_RS13605 in Dickeya dianthicola ME23
Annotation: purine nucleoside phosphoramidase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 84% identical to HINT_ECOLI: Purine nucleoside phosphoramidase (hinT) from Escherichia coli (strain K12)
KEGG orthology group: K12150, HIT-like protein HinT (inferred from 97% identity to dze:Dd1591_1633)MetaCyc: 84% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-
Predicted SEED Role
"YcfF/hinT protein: a purine nucleoside phosphoramidase"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XZW9 at UniProt or InterPro
Protein Sequence (116 amino acids)
>DZA65_RS13605 purine nucleoside phosphoramidase (Dickeya dianthicola ME23) MAEETIFSKIIRREIPADIVYQDELVTAFRDIAPRTPTHILIVPNVLIPTVNDTAPEHEA ALGRMITVAGSIARQEGIADDGYRLIINCNRHGGQEVYHIHMHLLGGRPLGPLLAG