Protein Info for DZA65_RS13460 in Dickeya dianthicola ME23

Annotation: YcbK family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF05951: Peptidase_M15_2" amino acids 33 to 182 (150 residues), 207.4 bits, see alignment E=9.2e-66 PF08291: Peptidase_M15_3" amino acids 77 to 175 (99 residues), 50.5 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 72% identical to YCBK_ECO57: Uncharacterized protein YcbK (ycbK) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03654)

MetaCyc: 72% identical to peptidoglycan L,D-endopeptidase (Escherichia coli K-12 substr. MG1655)
3.4.-.-

Predicted SEED Role

"FIG001587: exported protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D620 at UniProt or InterPro

Protein Sequence (182 amino acids)

>DZA65_RS13460 YcbK family protein (Dickeya dianthicola ME23)
MEHIDNHRRKWLALGGAALGIALLPGQSLASLSTARPRILTLNNINTGERIKVEFSDGRR
YNKEELSRLNHFFRDYRANKVKTIDPALFDQLYRLQVMLGSSKPVQLISGYRSYSTNEDL
RSHSKGVAKQSYHTQGKAMDFHIEGVQLANIRKAAMKMRAGGVGYYPQSNFVHIDTGAIR
TW