Protein Info for DZA65_RS13295 in Dickeya dianthicola ME23

Annotation: Fe-S cluster assembly protein SufD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR01981: FeS assembly protein SufD" amino acids 139 to 413 (275 residues), 270.8 bits, see alignment E=6.2e-85 PF01458: SUFBD_core" amino acids 171 to 397 (227 residues), 256.5 bits, see alignment E=1.1e-80

Best Hits

KEGG orthology group: K09015, Fe-S cluster assembly protein SufD (inferred from 95% identity to ddd:Dda3937_03666)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGJ3 at UniProt or InterPro

Protein Sequence (430 amino acids)

>DZA65_RS13295 Fe-S cluster assembly protein SufD (Dickeya dianthicola ME23)
MAGLPTNSNAQQALQQWQRLFDTVAPRADEARQHWQQVMQLGIPHRKLEHWKYTPLERLL
EHEFTTAATESTVTPAQRDALALPVDGWRLVFVDGRFSRALSDADTGPYQVEVIPSARRQ
PGLPPIQPEVFLHLTESLAVEQTLIQLDNGVTAEKPLYLLHISSGRSAALNTLHYRHHAR
IGAGASATLIEHYASLEGASHFSGARLTIDAGENSRTEHYKLGFEAAGSYHFAHNDLRLA
RAAQLHSHSFLLGAGLTRHHTSAQINGEGVTLSMNSLMVPTGSEVCDTRTWLEHNQGFGE
SRQLHKAIVRDRARGVFNGLIKVAPGALKTDGKMTNNNLLLGRLAEVDAKPQLEIYADDV
KCSHGATVGRIDEEQLFYLRSRGIGEQAAQQMIIFAFAAELTEAVRDDALRDAVLERVAR
RLQALGGETT