Protein Info for DZA65_RS13190 in Dickeya dianthicola ME23

Annotation: electron transporter RnfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF17996: CE2_N" amino acids 31 to 139 (109 residues), 105 bits, see alignment E=2.3e-34 PF13472: Lipase_GDSL_2" amino acids 149 to 316 (168 residues), 34.8 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 54% identity to cja:CJA_2889)

Predicted SEED Role

"Endoglucanase E precursor (EC 3.2.1.4) (EgE) (Endo-1,4-beta-glucanase E) (Cellulase E)" (EC 3.2.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.4

Use Curated BLAST to search for 3.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DGQ7 at UniProt or InterPro

Protein Sequence (355 amino acids)

>DZA65_RS13190 electron transporter RnfD (Dickeya dianthicola ME23)
MLVKLFIFLIFFLTLTVNAKIITADNHYLSYTGRIDFTDKNKPVISWPGTSIKANFTGRY
IAILLDDQNGMNYFNVIIDGNDQTPYVIQAMKGMHEYVISTSLCSGEHQIEIYKRTEGED
GLTIFHGIKIDDNAKLLTPLEQPKRKVEFYGDSITSGLAVEASINGNENNPAEKNNYLTY
SSITGRALHAEVHTISQSGIGVMNSWFDFTMPDFYDQLNANGNNDSKWDFSTWTPDIVIV
NLLQNDSWIYNTLKIKPSSEDIIENYISFIRNLRLKYPHTHIICALGSMDATKPGSVWPS
YINAAVERMKNRYNDPNISTLFFDFNGYEAHPRQYQNLINSAVLIKEIERIMNWD