Protein Info for DZA65_RS13030 in Dickeya dianthicola ME23

Annotation: orotidine-5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00215: OMPdecase" amino acids 24 to 245 (222 residues), 232.8 bits, see alignment E=2.3e-73 TIGR01740: orotidine 5'-phosphate decarboxylase" amino acids 26 to 245 (220 residues), 188.2 bits, see alignment E=8.2e-60

Best Hits

Swiss-Prot: 80% identical to PYRF_SALEP: Orotidine 5'-phosphate decarboxylase (pyrF) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 96% identity to ddd:Dda3937_04038)

MetaCyc: 76% identical to orotidine-5'-phosphate decarboxylase (Escherichia coli K-12 substr. MG1655)
Orotidine-5'-phosphate decarboxylase. [EC: 4.1.1.23]

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYN3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>DZA65_RS13030 orotidine-5'-phosphate decarboxylase (Dickeya dianthicola ME23)
MLNDGIIPVNGSHTSSNTTVIGSPIIVALDYADQRAAYDFVDHIDPKDCRLKVGKEMFTL
FGPQLVKDLQQRGFEVFLDLKFHDIPNTTARAVAAAAELGVWMVNVHASGGARMMTAARE
ALTPFGRNAPLLIAVTVLTSMDEADLHGLGITLSPAEQAEKLARLTQQCGLDGVVCSAHE
AVRLKQACGTDFRLVTPGIRPAGSDAGDQRRIMTPQQAQQAGVDYMVIGRPITQSAEPAQ
TLKTILASLGGQ