Protein Info for DZA65_RS12990 in Dickeya dianthicola ME23

Annotation: DUF2335 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details PF10097: DUF2335" amino acids 55 to 104 (50 residues), 81.2 bits, see alignment E=2.1e-27

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_03105)

Predicted SEED Role

"probable inner membrane protein NMA0456"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3C5 at UniProt or InterPro

Protein Sequence (157 amino acids)

>DZA65_RS12990 DUF2335 domain-containing protein (Dickeya dianthicola ME23)
MQNAEAQNRENEEARALAEKVESTLIENPVFLERLLARPQIKAIVSSTFFRGPLPPPEML
KEYDDIVPNGAERIMAKSEREQAHRHRITEKSLDGEMSRDKRGQWMAFAITMTILVIATL
FAWKGEMVFAGTLITLDLIGLASVFVIGRYRPSTNDE